Total number of results for Myxine glutinosa are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02688 |
LSETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR
|
101 | Myxine glutinosa | Insulin | Insulin-like growth factor | ||
| NP05381 |
AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
|
34 | Myxine glutinosa | Somastostatin | Somatostatin-34 | 2896118#Conlon JM, Askensten U, Falkmer S, Thim L#Primary structures of somatostatins from the islet organ of the hagfish suggest an anomalous pathway of posttranslational processing of prosomatostatin-1#Endocrinology 1988 May;122(5):1855-9 |